Product Added to your Cart
x

-------- OR --------

All schools' staff have free credit (use the order form): Pay 14 days after receiving order. GST receipt provided. No account setup required. Sales to the general public are via the shopping cart.

Read more...

search
NZD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPROMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Welcome to come-here.co.nz
$0.00

Stop battery theft from calculators

Stop battery theft from calculators

Blog category: Schools

This is a free solution provided with any calculator purchase on request

The same battery cover retention solution works on the following models:

  • Fx9750GII
  • Fx9750GIII
  • Fx9860GII
  • Fx9860GIII
  • Fx9750GA Plus







Compared to using tape, the perfect battery cover retention solution to deter battery theft from calculators would:
  • Not leave tape residue during removal
  • Be covert (i.e. not visible or obvious to defeat)
  • Be a reusable component, so that during battery replacement no special consumable need to be found
  • Require a tool to remove, but a tool that is relatively common
  • Be quick and easy to fit and remove if you know the secret and have the tool
  • Be free (made from a common item just lying around)
The solution above does all that
 
Pete Cross Thursday, 29 February 2024 1 Comments
Leave a reply
Optional, for replies


Your Comments
Karen Friday, 20 March 2026

Wow I'd not known about that this was a common occurrence. I'll show my granddaughter when her calculator comes

Reply
Blogs
Withdraw from contract